PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30136.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 331aa    MW: 37225.6 Da    PI: 5.6674
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30136.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-152168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++   +G g+W+ +ar  g+ R++k+c++rw +yl
       KHN30136.1 21 KGLWSPEEDDKLMNYMLNHGQGCWSDVARNAGLQRCGKSCRLRWINYL 68
                     678*******************************************97 PP

2Myb_DNA-binding50.64.4e-1674117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+++ + +lG++ W+ Ia++++ gRt++++k++w++
       KHN30136.1  74 RGAFSPQEEELIIHFHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 117
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-241471IPR009057Homeodomain-like
PROSITE profilePS5129417.2911668IPR017930Myb domain
SuperFamilySSF466894.12E-2819115IPR009057Homeodomain-like
SMARTSM007171.1E-102070IPR001005SANT/Myb domain
PfamPF002493.4E-142168IPR001005SANT/Myb domain
CDDcd001673.40E-92468No hitNo description
PROSITE profilePS5129425.20469123IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2572124IPR009057Homeodomain-like
SMARTSM007171.8E-1573121IPR001005SANT/Myb domain
PfamPF002496.8E-1574117IPR001005SANT/Myb domain
CDDcd001675.50E-1176116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MRKPEACNNN TKNNSNKKLR KGLWSPEEDD KLMNYMLNHG QGCWSDVARN AGLQRCGKSC  60
RLRWINYLRP DLKRGAFSPQ EEELIIHFHS LLGNRWSQIA ARLPGRTDNE IKNFWNSTIK  120
KRLKNMSSTT TTTSTSPNAS ETSISEPSNK DLNNMGGFIS TLHNKHAGFV PMFGSSPSPS  180
MMQTSTVFNN MIERFPMLEQ GLINMPASGG YFEGTGSTPC FSQCEVDNNK GSCYLENEVF  240
ESVNIGVEGD MFVPPLENVT CKREETTNSS YFDADINSIL NNCNNIGIAE NKAHHGVENL  300
FQQELATATG EWDFEELMKD VSSFPFLDFS Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-28712313128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1400961e-100BT140096.1 Lotus japonicus clone JCVI-FLLj-12H15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003542045.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A0B2R6U80.0A0A0B2R6U8_GLYSO; Transcription factor MYB46
STRINGGLYMA13G41470.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.16e-73myb domain protein 83
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]